Gget

gget

Overview

gget is a command-line bioinformatics tool and Python package providing unified access to 20+ genomic databases and analysis methods. Query gene information, sequence analysis, protein structures, viral sequences, expression data, disease associations, and mouse tissue/cell specificity metrics through a consistent interface. Most gget modules work both as command-line tools and as Python functions.

Important: The databases queried by gget are continuously updated, which sometimes changes their structure. Guidance here targets gget 0.30.5 (PyPI current as of 2026-06-07). For reproducible work, pin gget==0.30.5; for broken upstream database adapters, update gget after checking release notes.

Installation

Install gget in a clean virtual environment to avoid conflicts:

# Reproducible install targeting this skill
uv venv .venv
source .venv/bin/activate
uv pip install "gget==0.30.5"

# In Python/Jupyter
import gget

Quick Start

Basic usage pattern for all modules:

# Command-line
gget  [arguments] [options]

# Python
gget.module(arguments, options)

Most modules return:

• Command-line: JSON (default) or CSV with -csv flag
• Python: DataFrame or dictionary

Common flags across modules:

• -o/--out: Save results to file
• -q/--quiet: Suppress progress information
• -csv: Return CSV format (command-line only)

Python argument names generally match long CLI options without leading dashes. For example, --census_version becomes census_version=.... Use gget --help for the exact current signature.

Module Categories

1. Reference & Gene Information

gget ref - Reference Genome Downloads

Retrieve download links and metadata for Ensembl reference genomes.

Parameters:

• species: Genusspecies format (e.g., 'homosapiens', 'mus_musculus'). Shortcuts: 'human', 'mouse'
• -w/--which: Specify return types as comma-separated CLI values or Python list (gtf, cdna, dna, cds, cdrna, pep). Default: all
• -r/--release: Ensembl release number (default: latest)
• -od/--out_dir: Directory for downloaded files
• -l/--list_species: List available vertebrate species
• -liv/--list_iv_species: List available invertebrate species
• -ftp: Return only FTP links
• -d/--download: Download files (requires curl)

Examples:

# List available species
gget ref --list_species

# Get all reference files for human
gget ref homo_sapiens

# Download GTF and cDNA files for mouse
gget ref -w gtf,cdna -d mouse

# Python
gget.ref("homo_sapiens")
gget.ref("mus_musculus", which=["gtf", "cdna"], download=True)

gget search - Gene Search

Locate genes by name, description, and Ensembl synonyms across species.

Parameters:

• searchwords: One or more search terms (case-insensitive)
• -s/--species: Target species (e.g., 'homo_sapiens', 'mouse')
• -r/--release: Ensembl release number
• -t/--id_type: Return 'gene' (default) or 'transcript'
• -ao/--andor: 'or' (default) finds ANY searchword; 'and' requires ALL
• -l/--limit: Maximum results to return
• wrap_text: Python-only display helper for wide DataFrames

Returns: ensemblid, genename, ensembldescription, extref_description, biotype, URL

Examples:

# Search for GABA-related genes in human
gget search -s human gaba gamma-aminobutyric

# Find specific gene, require all terms
gget search -s mouse -ao and pax7 transcription

# Python
gget.search(["gaba", "gamma-aminobutyric"], species="homo_sapiens")

gget info - Gene/Transcript Information

Retrieve comprehensive gene and transcript metadata from Ensembl, UniProt, and NCBI.

Parameters:

• ens_ids: One or more Ensembl IDs (also supports WormBase, Flybase IDs). Limit: ~1000 IDs
• -n/--ncbi: Disable NCBI data retrieval
• -u/--uniprot: Disable UniProt data retrieval
• -pdb: Include PDB identifiers (increases runtime)

Returns: UniProt ID, NCBI gene ID, primary gene name, synonyms, protein names, descriptions, biotype, canonical transcript

Examples:

# Get info for multiple genes
gget info ENSG00000034713 ENSG00000104853 ENSG00000170296

# Include PDB IDs
gget info ENSG00000034713 -pdb

# Python
gget.info(["ENSG00000034713", "ENSG00000104853"], pdb=True)

gget seq - Sequence Retrieval

Fetch nucleotide or amino acid sequences for genes and transcripts.

Parameters:

• ens_ids: One or more Ensembl identifiers
• -t/--translate: Fetch amino acid sequences instead of nucleotide
• -iso/--isoforms: Return all transcript variants (gene IDs only)

Returns: FASTA format sequences

Examples:

# Get nucleotide sequences
gget seq ENSG00000034713 ENSG00000104853

# Get all protein isoforms
gget seq -t -iso ENSG00000034713

# Python
gget.seq(["ENSG00000034713"], translate=True, isoforms=True)

2. Sequence Analysis & Alignment

gget blast - BLAST Searches

BLAST nucleotide or amino acid sequences against standard databases.

Parameters:

• sequence: Sequence string or path to FASTA/.txt file
• -p/--program: blastn, blastp, blastx, tblastn, tblastx (auto-detected)
• -db/--database:
• Nucleotide: nt, refseq_rna, pdbnt
• Protein: nr, swissprot, pdbaa, refseq_protein
• -l/--limit: Max hits (default: 50)
• -e/--expect: E-value cutoff (default: 10.0)
• -lcf/--low_comp_filt: Enable low complexity filtering
• -mbo/--megablast_off: Disable MegaBLAST (blastn only)

Examples:

# BLAST protein sequence
gget blast MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR

# BLAST from file with specific database
gget blast sequence.fasta -db swissprot -l 10

# Python
gget.blast("MKWMFK...", database="swissprot", limit=10)

gget blat - BLAT Searches

Locate genomic positions of sequences using UCSC BLAT.

Parameters:

• sequence: Sequence string or path to FASTA/.txt file
• -st/--seqtype: 'DNA', 'protein', 'translated%20RNA', 'translated%20DNA' (auto-detected)
• -a/--assembly: Target assembly (default: 'human'/hg38; options: 'mouse'/mm39, 'zebrafinch'/taeGut2, etc.)

Returns: genome, query size, alignment positions, matches, mismatches, alignment percentage

Examples:

# Find genomic location in human
gget blat ATCGATCGATCGATCG

# Search in different assembly
gget blat -a mm39 ATCGATCGATCGATCG

# Python
gget.blat("ATCGATCGATCGATCG", assembly="mouse")

gget muscle - Multiple Sequence Alignment

Align multiple nucleotide or amino acid sequences using Muscle5.

Parameters:

• fasta: Sequences or path to FASTA/.txt file
• -s5/--super5: Use Super5 algorithm for faster processing (large datasets)

Returns: Aligned sequences in ClustalW format or aligned FASTA (.afa)

Examples:

# Align sequences from file
gget muscle sequences.fasta -o aligned.afa

# Use Super5 for large dataset
gget muscle large_dataset.fasta -s5

# Python
gget.muscle("sequences.fasta", save=True)

gget diamond - Local Sequence Alignment

Perform fast local protein alignment or translated nucleotide-to-protein alignment using DIAMOND.

Parameters:

• Query: Sequences (string/list) or FASTA file path
• -ref/--reference: Reference sequences (string/list) or FASTA file path (required)
• -s/--sensitivity: fast, mid-sensitive, sensitive, more-sensitive, very-sensitive (default), ultra-sensitive
• -t/--threads: CPU threads (default: 1)
• -db/--diamond_db: Save database for reuse
• -x/--translated: Enable nucleotide query to amino acid reference alignment

Returns: Identity percentage, sequence lengths, match positions, gap openings, E-values, bit scores

Examples:

# Align against reference
gget diamond GGETISAWESQME -ref reference.fasta -t 4

# Translate nucleotide query against amino acid reference
gget diamond query_nt.fasta -ref proteins.fasta --translated

# Python
gget.diamond("GGETISAWESQME", reference="reference.fasta", threads=4)
gget.diamond("ATGGGC...", reference="proteins.fasta", translated=True)

3. Structural & Protein Analysis

gget pdb - Protein Structures

Query RCSB Protein Data Bank for structure and metadata.

Parameters:

• pdb_id: PDB identifier (e.g., '7S7U')
• -r/--resource: Data type (pdb, entry, pubmed, assembly, entity types)
• -i/--identifier: Assembly, entity, or chain ID

Returns: PDB format (structures) or JSON (metadata)

Examples:

# Download PDB structure
gget pdb 7S7U -o 7S7U.pdb

# Get metadata
gget pdb 7S7U -r entry

# Python
gget.pdb("7S7U", save=True)

gget alphafold - Protein Structure Prediction

Predict 3D protein structures using simplified AlphaFold2.

Setup Required:

# Installs modified third-party dependencies and downloads model parameters
gget setup alphafold

Parameters:

• sequence: Amino acid sequence (string), multiple sequences (list), or FASTA file. Multiple sequences trigger multimer modeling
• -mr/--multimer_recycles: Recycling iterations (default: 3; recommend 20 for accuracy)
• -mfm/--multimer_for_monomer: Apply multimer model to single proteins
• -r/--relax: AMBER relaxation for top-ranked model
• plot: Python-only; generate interactive 3D visualization (default: True)
• show_sidechains: Python-only; include side chains (default: True)

Returns: PDB structure file, JSON alignment error data, optional 3D visualization

Examples:

# Predict single protein structure
gget alphafold MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR

# Predict multimer with higher accuracy
gget alphafold sequence1.fasta -mr 20 -r

# Python with visualization
gget.alphafold("MKWMFK...", plot=True, show_sidechains=True)

# Multimer prediction
gget.alphafold(["sequence1", "sequence2"], multimer_recycles=20)

gget elm - Eukaryotic Linear Motifs

Predict Eukaryotic Linear Motifs in protein sequences.

Setup Required:

gget setup elm

Parameters:

• sequence: Amino acid sequence or UniProt Acc
• -u/--uniprot: Indicates sequence is UniProt Acc
• -e/--expand: Include protein names, organisms, references
• -s/--sensitivity: DIAMOND alignment sensitivity (default: "very-sensitive")
• -t/--threads: Number of threads (default: 1)

Returns: Two outputs:

1. ortholog_df: Linear motifs from orthologous proteins
2. regex_df: Motifs directly matched in input sequence

Examples:

# Predict motifs from sequence
gget elm LIAQSIGQASFV -o results

# Use UniProt accession with expanded info
gget elm --uniprot Q02410 -e

# Python
ortholog_df, regex_df = gget.elm("LIAQSIGQASFV")

4. Expression & Disease Data

gget archs4 - Gene Correlation & Tissue Expression

Query ARCHS4 database for correlated genes or tissue expression data.

Parameters:

• gene: Gene symbol or Ensembl ID (with --ensembl flag)
• -w/--which: 'correlation' (default, returns 100 most correlated genes) or 'tissue' (expression atlas)
• -s/--species: 'human' (default) or 'mouse' (tissue data only)
• -e/--ensembl: Input is Ensembl ID

Returns:

• Correlation mode: Gene symbols, Pearson correlation coefficients
• Tissue mode: Tissue identifiers, min/Q1/median/Q3/max expression values

Examples:

# Get correlated genes
gget archs4 ACE2

# Get tissue expression
gget archs4 -w tissue ACE2

# Python
gget.archs4("ACE2", which="tissue")

gget cellxgene - Single-Cell RNA-seq Data

Query CZ CELLxGENE Discover Census for single-cell data.

Setup Required:

gget setup cellxgene

Parameters:

• --gene (-g): Gene names or Ensembl IDs (case-sensitive! 'PAX7' for human, 'Pax7' for mouse)
• --tissue: Tissue type(s)
• --cell_type: Specific cell type(s)
• --species (-s): 'homosapiens' (default) or 'musmusculus'
• --census_version (-cv): Version ("stable", "latest", or dated)
• --ensembl (-e): Use Ensembl IDs
• --meta_only (-mo): Return metadata only
• Additional filters: disease, developmentstage, sex, assay, datasetid, donorid, ethnicity, suspensiontype

Returns: AnnData object with count matrices and metadata (or metadata-only dataframes)

Examples:

# Get single-cell data for specific genes and cell types
gget cellxgene --gene ACE2 ABCA1 --tissue lung --cell_type "mucus secreting cell" -o lung_data.h5ad

# Metadata only
gget cellxgene --gene PAX7 --tissue muscle --meta_only -o metadata.csv

# Python
adata = gget.cellxgene(gene=["ACE2", "ABCA1"], tissue="lung", cell_type="mucus secreting cell")

gget enrichr - Enrichment Analysis

Perform ontology enrichment analysis on gene lists using Enrichr.

Parameters:

• genes: Gene symbols or Ensembl IDs
• -db/--database: Reference database (supports shortcuts: 'pathway', 'transcription', 'ontology', 'diseases_drugs', 'celltypes')
• -s/--species: human (default), mouse, fly, yeast, worm, fish
• -bkg_l/--background_list: Background genes for comparison
• -ko/--kegg_out: Save KEGG pathway images with highlighted genes
• plot: Python-only; generate graphical results

Database Shortcuts:

• 'pathway' → KEGG2021Human
• 'transcription' → ChEA_2016
• 'ontology' → GOBiologicalProcess_2021
• 'diseasesdrugs' → GWASCatalog_2019
• 'celltypes' → PanglaoDBAugmented2021

Examples:

# Enrichment analysis for ontology
gget enrichr -db ontology ACE2 AGT AGTR1

# Save KEGG pathways
gget enrichr -db pathway ACE2 AGT AGTR1 -ko ./kegg_images/

# Python with plot
gget.enrichr(["ACE2", "AGT", "AGTR1"], database="ontology", plot=True)

gget bgee - Orthology & Expression

Retrieve orthology and gene expression data from Bgee database.

Parameters:

• ens_id: Ensembl gene ID or NCBI gene ID (for non-Ensembl species). Multiple IDs supported when type=expression
• -t/--type: 'orthologs' (default) or 'expression'

Returns:

• Orthologs mode: Matching genes across species with IDs, names, taxonomic info
• Expression mode: Anatomical entities, confidence scores, expression status

Examples:

# Get orthologs
gget bgee ENSG00000169194

# Get expression data
gget bgee ENSG00000169194 -t expression

# Multiple genes
gget bgee ENSBTAG00000047356 ENSBTAG00000018317 -t expression

# Python
gget.bgee("ENSG00000169194", type="orthologs")

gget opentargets - Disease & Drug Associations

Retrieve disease and drug associations from OpenTargets.

Parameters:

• Ensembl gene ID (required)
• -r/--resource: diseases (default), drugs, tractability, pharmacogenetics, expression, depmap, interactions
• -l/--limit: Cap results count
• --filters: Exact-match filters using returned OpenTargets column names; repeat on the CLI or pass a Python dict
• -or/--or: CLI-only; combine filters with OR logic instead of the default AND logic

Current notes:

• gget 0.30.5 rewrote this module for the newer OpenTargets API; some output column names differ from older releases.
• The older --filter_mode argument was removed upstream.

Examples:

# Get associated diseases
gget opentargets ENSG00000169194 -r diseases -l 5

# Get associated drugs
gget opentargets ENSG00000169194 -r drugs -l 10

# Filter interactions by returned column names
gget opentargets ENSG00000169194 -r interactions --filters protein_a_id=P35225 --filters gene_b_id=ENSG00000077238

# Python
gget.opentargets("ENSG00000169194", resource="diseases", limit=5)
gget.opentargets(
    "ENSG00000169194",
    resource="interactions",
    filters={"protein_a_id": "P35225", "gene_b_id": "ENSG00000077238"},
)

gget cbio - cBioPortal Cancer Genomics

Plot cancer genomics heatmaps using cBioPortal data.

Two subcommands:

search - Find study IDs:

gget cbio search breast lung

…

## Source & license

This open-source skill is cataloged on AgentStack and links to its original source — we do not rehost the code.

- **Author:** [K-Dense-AI](https://github.com/K-Dense-AI)
- **Source:** [K-Dense-AI/scientific-agent-skills](https://github.com/K-Dense-AI/scientific-agent-skills)
- **License:** MIT
- **Homepage:** https://k-dense.ai

Install and usage instructions live in the source repository linked above.